SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451257 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451257
Domain Number 1 Region: 73-248
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.97e-51
Family Ankyrin repeat 0.0000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451257   Gene: ENSG00000100906   Transcript: ENST00000557140
Sequence length 274
Comment pep:novel chromosome:GRCh38:14:35401540:35404746:-1 gene:ENSG00000100906 transcript:ENST00000557140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQLTWGRPSTRIQQQLGQLTLENLQMLPES
EDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL
Download sequence
Identical sequences G3V3I4
ENSP00000451257 ENSP00000451257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]