SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451562 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451562
Domain Number 1 Region: 36-159
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000243
Family FAD/NAD-linked reductases, N-terminal and central domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451562   Gene: ENSG00000119723   Transcript: ENST00000554920
Sequence length 200
Comment pep:putative chromosome:GRCh38:14:73950308:73963112:1 gene:ENSG00000119723 transcript:ENST00000554920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLVSRCGAVRAAPHSGPLVSWRRWSGASTDTVYDVVVSGGGLVGAAMACALGYDIHF
HDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQV
WDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSGTDYGLCKQMSTPLLKKDYV
DEKEHPAQDPSYIFSRSYLI
Download sequence
Identical sequences G3V434
ENSP00000451562 ENSP00000451562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]