SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452034 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452034
Domain Number 1 Region: 47-140
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 8.37e-34
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 2 Region: 144-234
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 4.05e-33
Family eIF-2-alpha, C-terminal domain 0.00000396
Further Details:      
 
Domain Number 3 Region: 2-50
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000323
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452034   Gene: ENSG00000134001   Transcript: ENST00000555876
Sequence length 252
Comment pep:putative chromosome:GRCh38:14:67364898:67382681:1 gene:ENSG00000134001 transcript:ENST00000555876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFT
KSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSIL
DSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENM
PIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEVRSIDSFLI
MTQEVPKRSSCR
Download sequence
Identical sequences H0YJS4
ENSP00000452034 ENSP00000452034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]