SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452057 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452057
Domain Number 1 Region: 19-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-18
Family Canonical RBD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452057   Gene: ENSG00000119705   Transcript: ENST00000557623
Sequence length 98
Comment pep:putative chromosome:GRCh38:14:77708103:77721107:1 gene:ENSG00000119705 transcript:ENST00000557623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHR
GLGWVQFSSEEGLRNALQQENHIIDGVKCLKSQPTIRS
Download sequence
Identical sequences A0A2I2YDW3 G3V4X6
ENSP00000452057 ENSP00000452057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]