SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452081 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452081
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-62
Family ALDH-like 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452081   Gene: ENSG00000119711   Transcript: ENST00000555126
Sequence length 252
Comment pep:putative chromosome:GRCh38:14:74060415:74069258:-1 gene:ENSG00000119711 transcript:ENST00000555126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVEHAKNL
RVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTI
ISNVKPNMTCYKEEIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHL
VDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATL
SSPAVVMPTMGR
Download sequence
Identical sequences G3V4Z4
ENSP00000452081 ENSP00000452081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]