SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452347 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452347
Domain Number 1 Region: 29-120
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.000000144
Family Hemopexin-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452347   Gene: ENSG00000273171   Transcript: ENST00000555059
Sequence length 148
Comment pep:putative chromosome:GRCh38:17:28364288:28368012:-1 gene:ENSG00000273171 transcript:ENST00000555059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWL
SLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRWQRVGFPPE
KADHLQQRAATGAGEGVCSMALPQHQHP
Download sequence
Identical sequences H0YJW9
ENSP00000452347 ENSP00000452347 ENSP00000460756 ENSP00000452347 ENSP00000460756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]