SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452488 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000452488
Domain Number - Region: 72-123
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.0942
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452488   Gene: ENSG00000012963   Transcript: ENST00000555329
Sequence length 124
Comment pep:novel chromosome:GRCh38:14:93218681:93227225:1 gene:ENSG00000012963 transcript:ENST00000555329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVEQNSEPCAGSSSESDLQKMYGDLDVLFLTDEYDTVLAYENKGKIAQATDRSDPLMDTL
SSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGMQ
YYCS
Download sequence
Identical sequences H0YJY4
ENSP00000452488 ENSP00000452488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]