SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452588 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452588
Domain Number 1 Region: 101-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000384
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452588   Gene: ENSG00000027075   Transcript: ENST00000553830
Sequence length 144
Comment pep:putative chromosome:GRCh38:14:61326913:61445721:1 gene:ENSG00000027075 transcript:ENST00000553830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAGDMGRQEELEAASWKDLGAPSGRKDWLGRIPGCFPGSALPKTLCSLQPWRASFSQF
LSEVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATY
LRQPTYCSHCREFIWGVFGKQGYQ
Download sequence
Identical sequences G3V5Y6
ENSP00000452588 ENSP00000452588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]