SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452631 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452631
Domain Number 1 Region: 124-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.32e-140
Family alpha-mannosidase 0.000000000925
Further Details:      
 
Domain Number 2 Region: 622-782
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.05e-29
Family alpha-mannosidase, C-terminal domain 0.0037
Further Details:      
 
Domain Number 3 Region: 502-616
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 5.23e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452631   Gene: ENSG00000196547   Transcript: ENST00000558161
Sequence length 796
Comment pep:known chromosome:GRCh38:15:90902926:90921191:1 gene:ENSG00000196547 transcript:ENST00000558161 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSISPQDCQFAL
GGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHAR
RSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVII
HAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQER
FSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQL
QLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGL
LKGSGLCFLAEHPKGG
Download sequence
Identical sequences A0A0C4DGL1
ENSP00000452631 ENSP00000452631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]