SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452648 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452648
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000549
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00011
Further Details:      
 
Domain Number 2 Region: 49-72
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000225
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452648   Gene: ENSG00000140307   Transcript: ENST00000559706
Sequence length 72
Comment pep:novel chromosome:GRCh38:15:59642214:59657521:-1 gene:ENSG00000140307 transcript:ENST00000559706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLN
TYRFCDNVWTFV
Download sequence
Identical sequences A0A2J8NS56 H0YK39
ENSP00000452648 ENSP00000452648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]