SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452749 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452749
Domain Number 1 Region: 88-221
Classification Level Classification E-value
Superfamily dUTPase-like 2.75e-46
Family dUTPase-like 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452749   Gene: ENSG00000128951   Transcript: ENST00000558472
Sequence length 221
Comment pep:novel chromosome:GRCh38:15:48331456:48342052:1 gene:ENSG00000128951 transcript:ENST00000558472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGAKTPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYD
YTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFN
FGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
Download sequence
Identical sequences H0YKC5
ENSP00000452749 ENSP00000452749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]