SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452850 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452850
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily ALDH-like 6.02e-19
Family ALDH-like 0.00000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452850   Gene: ENSG00000128918   Transcript: ENST00000561070
Sequence length 85
Comment pep:known chromosome:GRCh38:15:57995090:58036723:-1 gene:ENSG00000128918 transcript:ENST00000561070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADK
IHGMTIPVDGDYFTFTRHEPIGVCG
Download sequence
Identical sequences H0YKL3
ENSP00000452850 ENSP00000452850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]