SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452973 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452973
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily Plus3-like 3.27e-17
Family Plus3 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452973   Gene: ENSG00000137815   Transcript: ENST00000560447
Sequence length 171
Comment pep:putative chromosome:GRCh38:15:41474669:41477578:1 gene:ENSG00000137815 transcript:ENST00000560447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKEL
SIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQD
QLNELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVVRKLYLNH
Download sequence
Identical sequences H0YKX1
ENSP00000452973 ENSP00000452973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]