SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453322 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453322
Domain Number 1 Region: 72-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453322   Gene: ENSG00000069667   Transcript: ENST00000559343
Sequence length 153
Comment pep:putative chromosome:GRCh38:15:60511592:60593126:-1 gene:ENSG00000069667 transcript:ENST00000559343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVTVAPQTKPVFSTNELAHLSPPSAPASQRESGVGLRASCPTEWGQKVVRGAFRGALRA
EKRPAATAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLID
RTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKK
Download sequence
Identical sequences H0YLS5
ENSP00000453322 ENSP00000453322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]