SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453589 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453589
Domain Number 1 Region: 13-188
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.4e-41
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453589   Gene: ENSG00000140395   Transcript: ENST00000559848
Sequence length 189
Comment pep:known chromosome:GRCh38:15:78288339:78299597:-1 gene:ENSG00000140395 transcript:ENST00000559848 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSL
EGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQY
LATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATG
KLLHTLEGG
Download sequence
Identical sequences A0A2J8KCN0 A0A2J8SKB4 H0YMF9
ENSP00000453589 ENSP00000453589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]