SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453651 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453651
Domain Number 1 Region: 325-427
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.31e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 54-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 136-190,217-232,260-272
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453651   Gene: ENSG00000172379   Transcript: ENST00000533983
Sequence length 706
Comment pep:known chromosome:GRCh38:15:80441231:80597928:1 gene:ENSG00000172379 transcript:ENST00000533983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSEI
ERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPS
FLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDD
VEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHL
PLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKYCL
VAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDIL
EFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYI
ICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQER
DPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQ
SSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPS
SYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGE
QHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences A0A1D5Q695 A0A2J8KCA3 A0A2K5TW42 A0A2K6E1D2
9598.ENSPTRP00000012584 XP_005560309.1.63531 XP_005560310.1.63531 XP_008013852.1.81039 XP_008013854.1.81039 XP_011758843.1.29376 XP_011758844.1.29376 XP_016782767.1.37143 XP_016782768.1.37143 ENSP00000453651 ENSP00000453792 ENSP00000453651 ENSP00000453792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]