SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453667 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453667
Domain Number 1 Region: 26-125
Classification Level Classification E-value
Superfamily dUTPase-like 7.72e-34
Family dUTPase-like 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453667   Gene: ENSG00000128951   Transcript: ENST00000559935
Sequence length 133
Comment pep:putative chromosome:GRCh38:15:48331011:48341495:1 gene:ENSG00000128951 transcript:ENST00000559935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGAAPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYT
IPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFG
KEKFEDRIWRMCQ
Download sequence
Identical sequences H0YMM5
ENSP00000453667 ENSP00000453667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]