SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453683 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453683
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily dUTPase-like 4.97e-35
Family dUTPase-like 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453683   Gene: ENSG00000128951   Transcript: ENST00000558367
Sequence length 107
Comment pep:putative chromosome:GRCh38:15:48332406:48342033:1 gene:ENSG00000128951 transcript:ENST00000558367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCSIEKPSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDE
DYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDD
Download sequence
Identical sequences H0YMP1
ENSP00000453683 ENSP00000453683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]