SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453717 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453717
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily dUTPase-like 6.8e-50
Family dUTPase-like 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453717   Gene: ENSG00000128951   Transcript: ENST00000558813
Sequence length 141
Comment pep:known chromosome:GRCh38:15:48331405:48342293:1 gene:ENSG00000128951 transcript:ENST00000558813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVA
PRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIE
EVQALDDTERGSGGFGSTGKN
Download sequence
Identical sequences A0A0C4DGL3
ENSP00000453717 NP_001020420.1.87134 NP_001020420.1.92137 ENSP00000453717 gi|70906444|ref|NP_001020420.1| cath|current|2hquA00/24-164 cath|current|2hquB00/24-164 cath|current|3ehwA00/24-164 d2hqua_ d2hqub_ d3ehwa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]