SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453863 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453863
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 6.87e-24
Family LeuD-like 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453863   Gene: ENSG00000136381   Transcript: ENST00000559091
Sequence length 89
Comment pep:putative chromosome:GRCh38:15:78494210:78497338:1 gene:ENSG00000136381 transcript:ENST00000559091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLSG
RETFSLTFPEELSPGITLNIQVSLNFSNI
Download sequence
Identical sequences H0YN46
ENSP00000453863 ENSP00000453863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]