SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000454041 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454041
Domain Number 1 Region: 23-122
Classification Level Classification E-value
Superfamily dUTPase-like 6.41e-34
Family dUTPase-like 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454041   Gene: ENSG00000128951   Transcript: ENST00000559540
Sequence length 143
Comment pep:putative chromosome:GRCh38:15:48332210:48342395:1 gene:ENSG00000128951 transcript:ENST00000559540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPP
MEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEK
FEGMLNIYIHIILVNFQSHVCVN
Download sequence
Identical sequences H0YNJ9
ENSP00000454041 ENSP00000454041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]