SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454706 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000454706
Domain Number - Region: 4-62
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0112
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454706   Gene: ENSG00000140743   Transcript: ENST00000563573
Sequence length 63
Comment pep:putative chromosome:GRCh38:16:22349372:22433665:-1 gene:ENSG00000140743 transcript:ENST00000563573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEE
LKS
Download sequence
Identical sequences A0A2J8IR66
ENSP00000454706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]