SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000454729 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000454729
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00337
Family N-terminal domain of MutM-like DNA repair proteins 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454729   Gene: ENSG00000140398   Transcript: ENST00000568881
Sequence length 39
Comment pep:known chromosome:GRCh38:15:75347069:75349024:1 gene:ENSG00000140398 transcript:ENST00000568881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVP
Download sequence
Identical sequences A0A2J8KS66 A0A2J8UDM3 H3BN83
ENSP00000454729 ENSP00000454729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]