SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454827 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454827
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.66e-25
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454827   Gene: ENSG00000149927   Transcript: ENST00000567332
Sequence length 80
Comment pep:putative chromosome:GRCh38:16:30007232:30010991:-1 gene:ENSG00000149927 transcript:ENST00000567332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIA
VCDEDKLSHNEFIGEIRVPL
Download sequence
Identical sequences A0A2J8TKB9 H3BNF7
ENSP00000454827 ENSP00000454827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]