SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454965 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000454965
Domain Number - Region: 6-43
Classification Level Classification E-value
Superfamily SET domain 0.0105
Family RuBisCo LSMT catalytic domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454965   Gene: ENSG00000153786   Transcript: ENST00000566909
Sequence length 141
Comment pep:putative chromosome:GRCh38:16:84976496:84982117:-1 gene:ENSG00000153786 transcript:ENST00000566909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVL
FTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVM
FGTQIHSICNDETEIERLKSE
Download sequence
Identical sequences A0A2J8LEV3 A0A2J8T9K8 H3BNQ9
ENSP00000454965 ENSP00000454965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]