SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455267 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455267
Domain Number 1 Region: 106-233
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.75e-41
Family Endonuclease III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455267   Gene: ENSG00000065057   Transcript: ENST00000566380
Sequence length 236
Comment pep:novel chromosome:GRCh38:16:2039820:2047786:-1 gene:ENSG00000065057 transcript:ENST00000566380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAE
PLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKSKVKYIKQTSAILQ
QHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAAVDTHVHRIANRLRWTKKAT
KSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALCPAAQGL
Download sequence
Identical sequences H3BPD5
ENSP00000455267 ENSP00000455267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]