SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455274 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455274
Domain Number 1 Region: 30-88,116-289
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-81
Family Calponin-homology domain, CH-domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 1506-1730
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-53
Family Plakin repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 1734-1912
Classification Level Classification E-value
Superfamily Plakin repeat 1.27e-49
Family Plakin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 2362-2560
Classification Level Classification E-value
Superfamily Plakin repeat 3.23e-43
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 6271-6429
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 6708-6861
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-28
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 5396-5553
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-26
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 8 Region: 2654-2765
Classification Level Classification E-value
Superfamily Plakin repeat 1.1e-24
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 305-421
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-24
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 10 Region: 4850-5007
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 11 Region: 6861-6978
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 12 Region: 6511-6649
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 13 Region: 5285-5408
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-21
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 14 Region: 6927-7054,7081-7112
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-20
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 15 Region: 7221-7300
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.66e-20
Family GAS2 domain 0.00055
Further Details:      
 
Domain Number 16 Region: 6070-6211
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 17 Region: 5845-5983
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 18 Region: 5505-5651
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 19 Region: 5614-5767
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 3962-4091
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 21 Region: 2544-2649
Classification Level Classification E-value
Superfamily Plakin repeat 1.07e-16
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 6392-6501
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 23 Region: 1222-1348,1375-1401
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 7132-7212
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000138
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 5064-5224
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000271
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 26 Region: 4517-4641
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000312
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 27 Region: 4740-4861
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000304
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 28 Region: 3826-3949
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000348
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 29 Region: 4425-4529
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 677-779
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000648
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 31 Region: 4291-4390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000851
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 32 Region: 5772-5882
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000259
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 33 Region: 4072-4201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000518
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 34 Region: 5987-6097
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000864
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 35 Region: 586-675
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000981
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 36 Region: 4164-4284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 37 Region: 2282-2359
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000107
Family Plakin repeat 0.0019
Further Details:      
 
Domain Number 38 Region: 3606-3723
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000249
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 39 Region: 4649-4750
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000342
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 40 Region: 3438-3592
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000153
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 41 Region: 1419-1535
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000187
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000455274
Domain Number - Region: 784-857
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0151
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 5199-5277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455274   Gene: ENSG00000127603   Transcript: ENST00000564288
Sequence length 7555
Comment pep:putative chromosome:GRCh38:1:39204246:39487177:1 gene:ENSG00000127603 transcript:ENST00000564288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLDSSYLPPTIFILTHVLGVAGVLYWKRHARGRADERDRVQKKTFTKWVNKHLMKVRK
HINDLYEDLRDGHNLISLLEVLSGIKLEPAGLKTLRLVSMPSWCHTNNEEQAEEDDDDVP
REKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDI
YISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMER
VQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGE
GISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFKETEIL
AKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVER
LELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIR
QLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTT
THLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQMKLER
AEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYAETLGKLETQY
CKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRNYFSEL
TMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKEN
TAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSV
ASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQIEITICKNDECVLEDNSQRTKWKV
ISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRK
DLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEEEVEAC
KARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVVKRIQSLASSRTDRDAWQ
DNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHV
YGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEVVLADLSALEAHWSTLRHWLS
DVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVIAQLEI
RQSELESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTALFAE
IERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEF
MDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNT
QGKATSSETKESTDIEKAILEQQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLSEKEKK
QISEQLNALNKAYHDLCDGSANQLQQLQSQLAHQTEQKECRAVAGVIDLGTVEIFPIFKA
MQKGLLDQDTGLVLLESQVIMSGLIAPETGENLSLEEGIARNLINPQMYQQLRELQDALA
LISRLTESRGPLSVVEAIEKRIISETVGLKILEAHLATGGFSLSPSENCINLEEAFHQGL
ISAWLHSVLESYLRTSKNLIDPNTAEKIGLLDLMQRCIVHQESGFKLLPVKQLAGGMVSL
KSGRKVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMA
CAILIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESLWSFMGLLWPESGEIL
PITDALEQGIVSTELAHKILSNRQHIKALFLPATTEILSWKKAIESGILDRDLANNLKSI
CIPDVMPHMQLADSAEQNINPGAAVLPCSKSHPKATASQSENLLFQLMTHSYINVQNGQR
LLLLDKELMETLTSRDEYQTSPPKVVEIGHQRQKTPEGLQESANVKISGTFSSGWTVRLP
EFQFSSQNKEYPDREDCTTEKGKKTTVETEDSSVENPEQDLFVEQKERNPNIDALKVINK
VKLEVQRQLIGTQREDQTAVSVRENASRGHLLTIPPAEAEGVPLVVDKDVFSVETPKKEH
QPLRNTSFTCQNEQAHTLETEYIHDETGGSHIKPQSKKLQVQVKKTLGIKLELKSETDGN
VHPLDKKEMLKKTFLAKDDHKESQEAQNIAGGSMMMSEKTDEEDSGREIFLSCSHPLELL
EEATLNVLSAQLLDGGIFHEQTGQKLLLNEAISRGIVPSHTAVKLMEKLNMFQGFFDSQT
CESLTTEEVINEGLMDEKLLHNVLMADKAISGVLDPRTQTLCSVKDAVTVGLLDKETATR
ILERQVVTGGIIDLKRGKKVSVTLASTLGLVDVADQPELINLEKASKGRDAEKTVRERLI
SLQMETTGLIDPDSKAPLTVVQSIDRGLLEREEAVRLLTKQVVDGGIIHHISGMRLSVDN
AFRHGLIGEDLAEKLKRVENLNIHQIFNPETKENISLPKAIKLDLITSDLKREIQEVQAF
TGNFVDLISGQRLTLAEAKKEGLLTNEAVLSPGMMHGIVDPENCRIVPYSELVKKCKIDI
ESGQRYLEVIPFSDIKDGVSDKVLTLSQAIQLGKVDFASTLKVLEAQANTGGIIDTATGK
RLTLASALEEKLVDENMVRIIASHQVLNGGIVDIFSDQRVTLVEAIEKRLISPELANMIQ
IDSSEFSDHRAQIEKQEGIEVCALQNEFLGKDMLIACNQTAEMSCNKVEESERLFQVENQ
SAQEKVKVRVSDGEQAKKSREISLKEFGCKDQRKPRMSSDAKEFISIINPHNLKGKSLGQ
VSLTHPYSECDFKLKEVARNNMGNDTNEEQEKAVTKIEIISHMKQSTSCLDSEEIRENQG
EVILEVQETYCETSGKLPSEQVLQQPMNARVKSKREKREVIVEESIRTCKPAFLSEEKLY
QETAIRDEHDSHIKSQPREMTSSEKGKEADTEMGFSITFKIEESSSQVVPQGISVKHLDA
LTLFSSKQANEGKVNNLSLCLTLKPEENLSREIACGAQSEPFPCMTPRPEGLHYQESDGK
AQVTGPSQISKTDKSFQGTTRQETNYQDSWVTSKTKETKHQISSSNECKEKSYQEVSFDP
ARGLKLEEITVSRPDSKEVRYLEFSDRKDLHHQGSKSDDKLCGTLKSEIATQELTGEKFL
EMANPNVAGLEAGSIEDIVTQRGSRVLGSFLPEKLFKGVSQKENTGQQNAIISPTVLETS
EEKTVSLTVCSAVKTEKTPQEKLRESPGSEQTPFMTAPEGKGNGGVNPEPFRATQNVFTR
QLCLEHDEKLVSYLSLLRNIEMRTKQIQPLELNLAELQDLLCQAKVLERELKDLTTLVSQ
ELECVNQIIISQPQEVPAQLLKALEKDAKNLQKSLSSVSDTWNSRLLHFQNAVEIEKTKV
LNQHTQLEGRLQDLRAWVGNKNLILNSKGSNSEIDVDSLNLCLQQYEDLKQPMAERKAQL
DALAFDIQFFISEHAQDLSPQQNRQMLRLLNELQRSFQDILEQTAAQVDALQGHLQQMEQ
EALVKTLQKQQNTCHQQLEDLCSWVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDD
IQNRATSFATVVKDIEGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELE
EAVTSALQQETEKSKAAKELAENKKKIDALLDWVTSVGSSGGQLLTNLPGMEQLSGASLE
KGALDTTDGYMGVNQAPEKLDKQCEMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLT
PEEQQMLQQKLGELKEQYSTSLAQSEAELKQVQTLQDELQKFLQDHKEFESWLERSEKEL
ENMHKGGSSPETLPSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDMENSFKEGKEPSEI
GNLVKDKLKDATERYTALHSKCTRLGSHLNMLLGQYHQFQNSADSLQAWMQACEANVEKL
LSDTVASDPGVLQEQLATTKQLQEELAEHQVPVEKLQKVARDIMEIEGEPAPDHRHVQET
TDSILSHFQSLSYSLAERSSLLQKAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSS
GVIQEALATNMKLKQDIARQKSSLEATREMVTRFMETADSTTAAVLQGKLAEVSQRFEQL
CLQQQEKESSLKKLLPQAEMFEHLSGKLQQFMENKSRMLASGNQPDQDITHFFQQIQELN
LEMEDQQENLDTLEHLVTELSSCGFALDLCQHQDRVQNLRKDFTELQKTVKEREKDASSC
QEQLDEFRKLVRTFQKWLKETEGSIPPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEE
INCKGTSLENLIMEITAPDSQGKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLK
YEKLGGVLHERQESLQAILNRMEEVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKA
QAESNKAFLAELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVT
VARQRQLEESASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLK
EFEARRQQHEQLNEAAQGILTGPGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQ
AIVKSTQYQELLQDLSEKVRAVGQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEV
KEAQTLCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRINRLQAALASTQQFQQ
MFDELRTWLDDKQSQQAKNCPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESL
LLSVPPGEEKRTLQNQLVELKNHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIE
DCKAKMSELRVTLDPVQLESSLLRSKAMLNEVEKRRSLLEILNSAADILINSSEADEDGI
RDEKAGINQNMDAVTEELQAKTGSLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALG
SQACSNKNLEKLRAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEF
LEVKQRVNSGCVMMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIE
DVRLFLNKIHVLKLDIEASEAECRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQ
EQLELTLGRVEDFYRKLKGLNDATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVD
PLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLH
CGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQ
AEGGRIAQSAELADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPI
SDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTS
PAEQGVLSEKIDSLQARYSEIQDRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKL
SSVFVKDFKQDVLHRQHADHLALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKL
DGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGE
QIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVS
DTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKA
FSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLE
RAQVLVNQFWETYEELSPWIEETRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPH
IDKLLKIGPQLKELNPEEGEMVEEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQFHDK
IEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGEELI
GRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTT
IKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETE
KPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTM
PPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTE
LKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVI
EVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWESVLQK
TEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELY
SQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEE
ALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQI
IELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEA
WKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALK
EKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYK
VEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWV
KGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALP
DDTEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARF
EEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKAL
IAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPMPIL
SQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWM
NHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDY
YEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGD
SQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHPGSKIKRSDSSSSISSQSPIA
RGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPS
SPATPASGTKTSLQFSRCYDKPWLVNSKAGTPIRDSHSPDLQLPTPEVIPSSGSKLKRPT
PTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDAS
DFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences H3BPE1
ENSP00000455274 ENSP00000455274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]