SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455374 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455374
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 1.72e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 379-481
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-24
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 3 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000146
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 497-567
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000106
Family Integrin beta tail domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455374   Gene: ENSG00000139626   Transcript: ENST00000550743
Sequence length 650
Comment pep:novel chromosome:GRCh38:12:53191371:53200443:-1 gene:ENSG00000139626 transcript:ENST00000550743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWC
KERTLDNQLFFFLVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRL
SVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL
Download sequence
Identical sequences ENSP00000455374 ENSP00000345501 ENSP00000455374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]