SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455507 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455507
Domain Number 1 Region: 7416-7698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.88e-75
Family Protein kinases, catalytic subunit 0.00000576
Further Details:      
 
Domain Number 2 Region: 8624-8903
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-48
Family Protein kinases, catalytic subunit 0.0000664
Further Details:      
 
Domain Number 3 Region: 6652-6836
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-30
Family DBL homology domain (DH-domain) 0.00063
Further Details:      
 
Domain Number 4 Region: 6845-6965
Classification Level Classification E-value
Superfamily PH domain-like 4.42e-30
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 
Domain Number 5 Region: 5472-5585
Classification Level Classification E-value
Superfamily Fibronectin type III 9.11e-24
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 6 Region: 6077-6173
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-23
Family I set domains 0.0058
Further Details:      
 
Domain Number 7 Region: 9-99
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-22
Family I set domains 0.004
Further Details:      
 
Domain Number 8 Region: 7312-7404
Classification Level Classification E-value
Superfamily Immunoglobulin 7.41e-21
Family I set domains 0.004
Further Details:      
 
Domain Number 9 Region: 8419-8508
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 10 Region: 6967-7068
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-20
Family I set domains 0.0081
Further Details:      
 
Domain Number 11 Region: 7059-7158
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-20
Family I set domains 0.0091
Further Details:      
 
Domain Number 12 Region: 239-332
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 13 Region: 4839-4932
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-19
Family I set domains 0.034
Further Details:      
 
Domain Number 14 Region: 3068-3161
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-19
Family I set domains 0.041
Further Details:      
 
Domain Number 15 Region: 5855-5947
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-19
Family I set domains 0.0051
Further Details:      
 
Domain Number 16 Region: 108-201
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-19
Family I set domains 0.0086
Further Details:      
 
Domain Number 17 Region: 2533-2626
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 18 Region: 6325-6428
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 19 Region: 6217-6317
Classification Level Classification E-value
Superfamily Immunoglobulin 9.04e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 20 Region: 2711-2804
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 21 Region: 1265-1345
Classification Level Classification E-value
Superfamily Immunoglobulin 1.64e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 22 Region: 1991-2087
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 23 Region: 3517-3610
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 24 Region: 3252-3340
Classification Level Classification E-value
Superfamily Immunoglobulin 4.25e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 25 Region: 4318-4406
Classification Level Classification E-value
Superfamily Immunoglobulin 5.39e-17
Family I set domains 0.026
Further Details:      
 
Domain Number 26 Region: 1708-1805
Classification Level Classification E-value
Superfamily Immunoglobulin 6.08e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 27 Region: 4223-4315
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 28 Region: 2900-2992
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 29 Region: 4575-4667
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 30 Region: 3613-3702
Classification Level Classification E-value
Superfamily Immunoglobulin 2.34e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 31 Region: 4757-4844
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 32 Region: 4663-4755
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 33 Region: 3965-4054
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 34 Region: 1156-1253
Classification Level Classification E-value
Superfamily Immunoglobulin 5.93e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 35 Region: 4134-4227
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 36 Region: 2271-2357
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 37 Region: 880-975
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 38 Region: 1340-1436
Classification Level Classification E-value
Superfamily Immunoglobulin 8.27e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 39 Region: 1800-1897
Classification Level Classification E-value
Superfamily Immunoglobulin 8.81e-16
Family I set domains 0.0098
Further Details:      
 
Domain Number 40 Region: 972-1069
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-16
Family I set domains 0.0083
Further Details:      
 
Domain Number 41 Region: 4046-4139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000112
Family I set domains 0.024
Further Details:      
 
Domain Number 42 Region: 4928-5022
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000116
Family I set domains 0.012
Further Details:      
 
Domain Number 43 Region: 1616-1713
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000226
Family I set domains 0.012
Further Details:      
 
Domain Number 44 Region: 4494-4583
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000444
Family I set domains 0.045
Further Details:      
 
Domain Number 45 Region: 1432-1528
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000558
Family I set domains 0.0077
Further Details:      
 
Domain Number 46 Region: 3338-3430
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000666
Family I set domains 0.017
Further Details:      
 
Domain Number 47 Region: 2191-2270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000871
Family I set domains 0.046
Further Details:      
 
Domain Number 48 Region: 4399-4491
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000888
Family I set domains 0.026
Further Details:      
 
Domain Number 49 Region: 5023-5113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000107
Family I set domains 0.01
Further Details:      
 
Domain Number 50 Region: 1914-1996
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000107
Family I set domains 0.0098
Further Details:      
 
Domain Number 51 Region: 1064-1160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000119
Family I set domains 0.017
Further Details:      
 
Domain Number 52 Region: 508-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000129
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 53 Region: 3789-3878
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000159
Family I set domains 0.027
Further Details:      
 
Domain Number 54 Region: 3871-3963
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000189
Family I set domains 0.021
Further Details:      
 
Domain Number 55 Region: 325-407
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000033
Family I set domains 0.011
Further Details:      
 
Domain Number 56 Region: 1527-1621
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000413
Family I set domains 0.014
Further Details:      
 
Domain Number 57 Region: 2632-2724
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000521
Family I set domains 0.0042
Further Details:      
 
Domain Number 58 Region: 3701-3790
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000053
Family I set domains 0.013
Further Details:      
 
Domain Number 59 Region: 2355-2448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000109
Family I set domains 0.011
Further Details:      
 
Domain Number 60 Region: 808-887
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000186
Family I set domains 0.025
Further Details:      
 
Domain Number 61 Region: 5199-5294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000875
Family I set domains 0.0098
Further Details:      
 
Domain Number 62 Region: 3436-3526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000016
Family I set domains 0.018
Further Details:      
 
Domain Number 63 Region: 2091-2169
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000226
Family I set domains 0.02
Further Details:      
 
Domain Number 64 Region: 5108-5203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000334
Family I set domains 0.035
Further Details:      
 
Domain Number 65 Region: 5390-5483
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000745
Family I set domains 0.012
Further Details:      
 
Domain Number 66 Region: 706-781
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000753
Family I set domains 0.016
Further Details:      
 
Domain Number 67 Region: 5291-5385
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000761
Family I set domains 0.017
Further Details:      
 
Domain Number 68 Region: 8499-8602
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000942
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 69 Region: 2988-3078
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000346
Family I set domains 0.015
Further Details:      
 
Domain Number 70 Region: 3167-3261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000383
Family I set domains 0.017
Further Details:      
 
Domain Number 71 Region: 425-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000059
Family I set domains 0.011
Further Details:      
 
Domain Number 72 Region: 5583-5653
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000704
Family I set domains 0.018
Further Details:      
 
Domain Number 73 Region: 2444-2537
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000188
Family I set domains 0.01
Further Details:      
 
Domain Number 74 Region: 6559-6621
Classification Level Classification E-value
Superfamily SH3-domain 0.000000177
Family SH3-domain 0.0049
Further Details:      
 
Domain Number 75 Region: 2810-2903
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000141
Family I set domains 0.015
Further Details:      
 
Domain Number 76 Region: 606-675
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000548
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455507   Gene: ENSG00000154358   Transcript: ENST00000570156
Sequence length 8923
Comment pep:known chromosome:GRCh38:1:228208130:228378874:1 gene:ENSG00000154358 transcript:ENST00000570156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPQFSGAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQ
DGDLYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIR
VREGSEATFRCRVGGSPRPAVSWSKDGRRLGEPDGPRVRVEELGEASALRIRAARPRDGG
TYEVRAENPLGAASAAAALVVDSDAADTASRPGTSTAALLAHLQRRREAMRAEGAPASPP
STGTRTCTVTEGKHARLSCYVTGEPKPETVWKKDGQLVTEGRRHVVYEDAQENFVLKILF
CKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRLQDLEVREKESATFLCEVPQPS
TEAAWFKEETRLWASAKYGIEEEGTERRLTVRNVSADDDAVYICETPEGSRTVAELAVQG
NLLRKLPRKTAVRVGDTAMFCVELAVPVGPVHWLRNQEEVVAGGRVAISAEGTRHTLTIS
QCCLEDVGQVAFMAGDCQTSTQFCVSAPRKPPLQPPVDPVVKARMESSVILSWSPPPHGE
RPVTIDGYLVEKKKLGTYTWIRCHEAEWVATPELTVADVAEEGNFQFRVSALNSFGQSPY
LEFPGTVHLAPKLAVRTPLKAVQAVEGGEVTFSVDLTVASAGEWFLDGQALKASSVYEIH
CDRTRHTLTIREVPASLHGAQLKFVANGIESSIRMEVRAAPGLTANKPPAAAAREVLARL
HEEAQLLAELSDQAAAVTWLKDGRTLSPGPKYEVQASAGRRVLLVRDVARDDAGLYECVS
RGGRIAYQLSVQGLARFLHKDMAGSCVDAVAGGPAQFECETSEAHVHVHWYKDGMELGHS
GERFLQEDVGTRHRLVAATVTRQDEGTYSCRVGEDSVDFRLRVSEPKAVFAKEQPACREV
QAEVGASATLSCEVAQDQMEVTWYKDGKKLSSSSKVHVEAVGCMRRLVVQQVGQADSGEY
SCEARGQRVSFRLDVAEPKVVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVTWYKDGK
KLSSSSKVCMEATGCTRRLVVQQAGQADAGEYSCEAGGQRLSFHLDVKEPKVVFAKDQVA
HSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSSLKVHVEAKGCRRRLVVQQAGKTD
AGDYSCEARGQRVSFRLHITEPKMMFAKEQSVHNEVQAEAGASAMLSCEVAQAQTEVTWY
KDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAGEYSCEAGGQRVSFHLHITEPKGVFAK
EQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKDGKKLSSSSKVRMEVKGCTRRLVVQQV
GKADAGEYSCEAGGQRVSFQLHITEPKAVFAKEQLVHNEVRTEAGASATLSCEVAQAQTE
VTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQAGQADAGEYTCEAGGQRLSFHLDVSEPKA
VFAKEQLAHRKVQAEAGAIATLSCEVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLV
VQQACQADTGEYSCEAGGQRLSFSLDVAEPKVVFAKEQPVHREVQAQAGASTTLSCEVAQ
AQTEVMWYKDGKKLSFSSKVRMEAVGCTRRLVVQQAGQAVAGEYSCEAGSQRLSFHLHVA
EPKAVFAKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSLKVHVEAAGCT
RRLVVQQAGQADTGEYSCEAGGQQLSFRLQVAEPKAVFAKEQPASREVQAEAGTSATLSC
EVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSFH
LHVAEPKVVFAKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRVEA
VGCTRRLVVQQAGQAEAGEYSCEAGGQQLSFRLQVAEPKAVFAKEQVVFAKDQPVHREVQ
AEAGTSTMLSCEVAQAQTEVMWYKDGKKLSSSSKMRVEAVGCTRRLVVQEAGQADAGEYS
CEAGGQRLSFHLHVAEPKVVFAKEQPACREVQAEAGASATLSCEVAQGQMEVTWYKDGKK
LSSSSKVHMEASGYTRRLVVQQAGQADAGEYSCEAGGQRLSFRLHVAELEPQISERPCRR
EPLVVKEHEDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHTLTVHGAQVLD
SAIYSCRVGAEGQDFPVQVEEVAAKFCRLLEPVCGELGGTVTLACELSPACAEVVWRCGN
TQLRVGKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHTSAQLTVSVPRVVKFMSGL
STVVAEEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAISQSGASHSLTISDLVLEDA
GQITVEAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVTLEVELTRPWPELRWTRNAT
ALAPGKNVEIHAEGARHRLVLHNVGFADRGFFGCETPDDKTQAKLTVEMRQVRLVRGLQA
VEAREQGTATMEVQLSHADVDGSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPEDSGL
MVFKAEGVHTSARLVVTELPVSFSRPLQDVVTTEKEKVTLECELSRPNVDVRWLKDGVEL
RAGKTMAIAAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQGRNIQIVRPLEDVE
VMEKDGATFSCEVSHDEVPGQWFWEGSKLRPTDNVRIRQEGRTYTLIYRRVLAEDAGEIQ
FVAENAESRAQLRVKELPVTLVRPLRDKIAMEKHRGVLECQVSRASAQVRWFKGSQELQP
GPKYELVSDGLYRKLIISDVHAEDEDTYTCDAGDVKTSAQFFVEEQSITIVRGLQDVTVM
EPAPAWFECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTGPVHF
TVGKSRSSARLVVSDIPVVLTRPLEPKTGRELQSVVLSCDFRPAPKAVQWYKDDTPLSPS
EKFKMSLEGQMAELRILRLMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQDAEATE
EGWASFSCELSHEDEEVEWSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRADAGIVRASS
LKVSTSARLEVRVKPVVFLKALDDLSAEERGTLALQCEVSDPEAHVVWRKDGVQLGPSDK
YDFLHTAGTRGLVVHDVSPEDAGLYTCHVGSEETRARVRVHDLHVGITKRLKTMEVLEGE
SCSFECVLSHESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSV
RGLTSKASLIVRERPAAIIKPLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQK
YDVVCEGTMAMLVIRGASLKDAGEYTCEVEASKSTASLHVEEKANCFTEELTNLQVEEKG
TAVFTCKTEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQ
AQSRAQLLVQGRRVHIIEDLEDVDVQEGSSATFRCRISPANYEPVHWFLDKTPLHANELN
EIDAQPGGYHVLTLRQLALKDSGTIYFEAGDQRASAALRVTEKPSVFSRELTDATITEGE
DLTLVCETSTCDIPVCWTKDGKTLRGSARCQLSHEGHRAQLLITGATLQDSGRYKCEAGG
ACSSSIVRVHARPVRFQEALKDLEVLEGGAATLRCVLSSVAAPVKWCYGNNVLRPGDKYS
LRQEGAMLELVVRNLRPQDSGRYSCSFGDQTTSATLTVTALPAQFIGKLRNKEATEGATA
TLRCELSKAAPVEWRKGSETLRDGDRYCLRQDGAMCELQIRGLAMVDAAEYSCVCGEERT
SASLTIRPMPAHFIGRLRHQESIEGATATLRCELSKAAPVEWRKGRESLRDGDRHSLRQD
GAVCELQICGLAVADAGEYSCVCGEERTSATLTVKALPAKFTEGLRNEEAVEGATAMLWC
ELSKVAPVEWRKGPENLRDGDRYILRQEGTRCELQICGLAMADAGEYLCVCGQERTSATL
TIRALPARFIEDVKNQEAREGATAVLQCELNSAAPVEWRKGSETLRDGDRYSLRQDGTKC
ELQIRGLAMADTGEYSCVCGQERTSAMLTVRALPIKFTEGLRNEEATEGATAVLRCELSK
MAPVEWWKGHETLRDGDRHSLRQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLTVRA
MPSKFIEGLRNEEATEGDTATLWCELSKAAPVEWRKGHETLRDGDRHSLRQDGSRCELQI
RGLAVVDAGEYSCVCGQERTSATLTVRALPARFIEDVKNQEAREGATAVLQCELSKAAPV
EWRKGSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLTVRALPAR
FTQDLKTKEASEGATATLQCELSKVAPVEWKKGPETLRDGGRYSLKQDGTRCELQIHDLS
VADAGEYSCMCGQERTSATLTVRALPARFTEGLRNEEAMEGATATLQCELSKAAPVEWRK
GLEALRDGDKYSLRQDGAVCELQIHGLAMADNGVYSCVCGQERTSATLTVRALPARFIED
MRNQKATEGATVTLQCKLRKAAPVEWRKGPNTLKDGDRYSLKQDGTSCELQIRGLVIADA
GEYSCICEQERTSATLTVRALPARFIEDVRNHEATEGATAVLQCELSKAAPVEWRKGSET
LRDGDRYSLRQDGTRCELQIRGLAVEDTGEYLCVCGQERTSATLTVRALPARFIDNMTNQ
EAREGATATLHCELSKVAPVEWRKGPETLRDGDRHSLRQDGTRCELQIRGLSVADAGEYS
CVCGQERTSATLTIRALPAKFTKGLRNEEATEGATAMLQCELSKVAPVEWRKGPETLRDG
DRYNLRQDGTRCELQIHGLSVADTGEYSCVCGQEKTSATLTVKAPQPVFREPLQSLQAEE
GSTATLQCELSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQREDTGEYTCTC
GSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRKGSLQLFPCAK
YQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQSMASLSVRVPRPKFKTRLQSLEQETGD
IARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEAKDTGEYACVT
GGQKTAASLRVTEPEVTIVRGLVDAEVTADEDVEFSCEVSRAGATGVQWCLQGLPLQSNE
VTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRAPEVTILEPLQDVQLSE
GQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLEDAGTVSF
HVGTCSSEAQLKVTAKNTVVRGLENVEALEGGEALFECQLSQPEVAAHTWLLDDEPVHTS
ENAEVVFFENGLRHLLLLKNLRPQDSCRVTFLAGDMVTSAFLTVRGWRLEILEPLKNAAV
RAGAQACFTCTLSEAVPVGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGE
VTFACRDAVASARLTVLGLPDPPEDAEVVARSSHTVTLSWAAPMSDGGGGLCGYRVEVKE
GATGQWRLCHELVPGPECVVDGLAPGETYRFRVAAVGPVGAGEPVHLPQTVRLAEPPKPV
PPQPSAPESRQVAAGEDVSLELEVVAEAGEVIWHKGMERIQPGGRFEVVSQGRQQMLVIK
GFTAEDQGEYHCGLAQGSICPAAATFQVALSPASVDEAPQPSLPPEAAQEGDLHLLWEAL
ARKRRMSREPTLDSISELPEEDGRSQRLPQEAEEVAPDLSEGYSTADELARTGDADLSHT
SSDDESRAGTPSLVTYLKKAGRPGTSPLASKVGAPAAPSVKPQQQQEPLAAVRPPLGDLS
TKDLGDPSMDKAAVKIQAAFKGYKVRKEMKQQEGPMFSHTFGDTEAQVGDALRLECVVAS
KADVRARWLKDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCYTCQVSNKFGQVTHS
ACVVVSGSESEAESSSGGELDDAFRRAARRLHRLFRTKSPAEVSDEELFLSADEGPAEPE
EPADWQTYREDEHFICIRFEALTEARQAVTRFQEMFATLGIGVEIKLVEQGPRRVEMCIS
KETPAPVVPPEPLPSLLTSDAAPVFLTELQNQEVQDGYPVSFDCVVTGQPMPSVRWFKDG
KLLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDY
DTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLK
VKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAY
SSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVH
WLREEAERGVLWIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSAS
LHVSGLPKVEEQEKVKEALISTFLQGTTQAISAQGLETASFADLGGQRKEEPLAAKEALG
HLSLAEVGTEEFLQKLTSQITEMVSAKITQAKLQVPGGDSDEDSKTPSASPRHGRSRPSS
SIQESSSESEDGDARGEIFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVR
TKPTKSSPSRQGWVSPAYLDRRLKLSPEWGAAEAPEFPGEAVSEDEYKARLSSVIQELLS
SEQAFVEELQFLQSHHLQHLERCPHVPIAVAGQKAVIFRNVRDIGRFHSSFLQELQQCDT
DDDVAMCFIKNQAAFEQYLEFLVGRVQAESVVVSTAIQEFYKKYAEEALLAGDPSQPPPP
PLQHYLEQPVERVQRYQALLKELIRNKARNRQNCALLEQAYAVVSALPQRAENKLHVSLM
ENYPGTLQALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNHLVICKPRRDSRTDTV
SYVFRNMMKLSSIDLNDQVEGDDRAFEVWQEREDSVRKYLLQARTAIIKSSWVKEICGIQ
QRLALPVWRPPDFEEELADCTAELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILI
EDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGE
DAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECE
LVNRLGSARASAELRIQSPMLQAQEQCHREQLVAAVEDTTLERADQEVTSVLKRLLGPKA
PGPSTGDLTGPGPCPRGAPALQETGSQPPVTGTSEAPAVPPRVPQPLLHEGPEQEPEAIA
RAQEWTVPIRMEGAAWPGAGTGELLWDVHSHVVRETTQRTYTYQAIDTHTARPPSMQVTI
EDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASKD
AGVYTCLAQNTGGQVLCKAELLVLGGDNEPDSEKQSHRRKLHSFYEVKEEIGRGVFGFVK
RVQHKGNKILCAAKFIPLRSRTRAQAYRERDILAALSHPLVTGLLDQFETRKTLILILEL
CSSEELLDRLYRKGVVTEAEVKVYIQQLVEGLHYLHSHGVLHLDIKPSNILMVHPAREDI
KICDFGFAQNITPAELQFSQYGSPEFVSPEIIQQNPVSEASDIWAMGVISYLSLTCSSPF
AGESDRATLLNVLEGRVSWSSPMAAHLSEDAKDFIKATLQRAPQARPSAAQCLSHPWFLK
SMPAEEAHFINTKQLKFLLARSRWQRSLMSYKSILVMRSIPELLRGPPDSPSLGVARHLC
RDTGGSSSSSSSSDNELAPFARAKSLPPSPVTHSPLLHPRGFLRPSASLPEEAEASERST
EAPAPPASPEGAGPPAAQGCVPRHSVIRSLFYHQAGESPEHGALAPGSRRHPARRRHLLK
GGYIAGALPGLREPLMEHRVLEEEAAREEQATLLAKAPSFETALRLPASGTHLAPGHSHS
LEHDSPSTPRPSSEACGEAQRLPSAPSGGAPIRDMGHPQGSKQLPSTGGHPGTAQPERPS
PDSPWGQPAPFCHPKQGSAPQEGCSPHPAVAPCPPGSFPPGSCKEAPLVPSSPFLGQPQA
PPAPAKASPPLDSKMGPGDISLPGRPKPGPCSSPGSASQASSSQVSSLRVGSSQVGTEPG
PSLDAEGWTQEAEDLSDSTPTLQRPQEQATMRKFSLGGRGGYAGVAGYGTFAFGGDAGGM
LGQGPMWARIAWAVSQSEEEEQEEARAESQSEEQQEARAESPLPQVSARPVPEVGRAPTR
SSPEPTPWEDIGQVSLVQIRDLSGDAEAADTISLDISEVDPAYLNLSDLYDIKYLPFEFM
IFRKVPKSAQPEPPSPMAEEELAEFPEPTWPWPGELGPHAGLEITEESEDVDALLAEAAV
GRKRKWSSPSRSLFHFPGRHLPLDEPAELGLRERVKASVEHISRILKGRPEGLEKEGPPR
KKPGLASFRLSGLKSWDRAPTFLRELSDETVVLGQSVTLACQVSAQPAAQATWSKDGAPL
ESSSRVLISATLKNFQLLTILVVVAEDLGVYTCSVSNALGTVTTTGVLRKAERPSSSPCP
DIGEVYADGVLLVWKPVESYGPVTYIVQCSLEGGSWTTLASDIFDCCYLTSKLSRGGTYT
FRTACVSKAGMGPYSSPSEQVLLGGPSHLASEEESQGRSAQPLPSTKTFAFQTQIQRGRF
SVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLAQLHAAYLSPRHLVL
ILELCSGPELLPCLAERASYSESEVKDYLWQMLSATQYLHNQHILHLDLRSENMIITEYN
LLKVVDLGNAQSLSQEKVLPSDKFKDYLETMELLEGQGAVPQTDIWAIGVTAFIMLSAEY
PVSSEGARDLQRGLRKGLVRLSRCYAGLSGGAVAFLRSTLCAQPWGRPCASSCLQCPWLT
EEGPACSRPAPVTFPTARLRVFVRNREKRRALLYKRHNLAQVR
Download sequence
Identical sequences A6NGQ3
NP_001258152.2.87134 NP_001258152.2.92137 ENSP00000455507 ENSP00000455507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]