SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455730 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455730
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 9.52e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000148
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.07e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000117
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.16e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455730   Gene: ENSG00000140398   Transcript: ENST00000569035
Sequence length 390
Comment pep:known chromosome:GRCh38:15:75347638:75355247:1 gene:ENSG00000140398 transcript:ENST00000569035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHCRPRKVKADIPSLEPEGTSAS
Download sequence
Identical sequences Q96FI4
gi|205360991|ref|NP_078884.2| ENSP00000347170 ENSP00000455730 ENSP00000457352 NP_078884.2.87134 NP_078884.2.92137 XP_005254716.1.92137 XP_006720743.1.92137 XP_006720744.1.92137 XP_011520304.1.92137 XP_011520305.1.92137 XP_011520306.1.92137 ENSP00000347170 9606.ENSP00000347170 ENSP00000347170 ENSP00000455730 ENSP00000457352 5itx_A 5itx_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]