SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455823 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455823
Domain Number 1 Region: 62-125,153-326
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-82
Family Calponin-homology domain, CH-domain 0.00000141
Further Details:      
 
Domain Number 2 Region: 1543-1767
Classification Level Classification E-value
Superfamily Plakin repeat 3.27e-53
Family Plakin repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 1771-1949
Classification Level Classification E-value
Superfamily Plakin repeat 1.27e-49
Family Plakin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 2399-2597
Classification Level Classification E-value
Superfamily Plakin repeat 3.23e-43
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 6308-6466
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 6745-6904
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 5322-5482
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-28
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 5433-5589
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-26
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 2691-2802
Classification Level Classification E-value
Superfamily Plakin repeat 1.11e-24
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 342-458
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-24
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 11 Region: 4887-5044
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 12 Region: 6898-7015
Classification Level Classification E-value
Superfamily Spectrin repeat 4.17e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 13 Region: 6548-6686
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 6964-7091,7118-7149
Classification Level Classification E-value
Superfamily Spectrin repeat 2.2e-20
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 15 Region: 7258-7337
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.66e-20
Family GAS2 domain 0.00055
Further Details:      
 
Domain Number 16 Region: 6107-6248
Classification Level Classification E-value
Superfamily Spectrin repeat 9.24e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 17 Region: 5880-6020
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 18 Region: 5542-5687
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 19 Region: 5653-5807
Classification Level Classification E-value
Superfamily Spectrin repeat 3.72e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 3999-4128
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 21 Region: 2581-2686
Classification Level Classification E-value
Superfamily Plakin repeat 1.07e-16
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 6431-6538
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 23 Region: 1259-1385,1412-1438
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 7169-7249
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000138
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 5101-5261
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000271
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 26 Region: 4554-4678
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000312
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 27 Region: 4777-4898
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000032
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 28 Region: 3863-3986
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000348
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 29 Region: 4462-4566
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 714-816
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000648
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 31 Region: 4328-4427
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000851
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 32 Region: 5809-5919
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000259
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 33 Region: 4109-4238
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000518
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 34 Region: 6024-6134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000777
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 35 Region: 623-712
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000981
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 36 Region: 4201-4321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 37 Region: 2319-2396
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000011
Family Plakin repeat 0.0019
Further Details:      
 
Domain Number 38 Region: 3643-3760
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000249
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 39 Region: 4686-4787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000036
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 40 Region: 3475-3629
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000155
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 41 Region: 1456-1572
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000187
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000455823
Domain Number - Region: 821-894
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0153
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 5236-5314
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455823   Gene: ENSG00000127603   Transcript: ENST00000567887
Sequence length 7592
Comment pep:putative chromosome:GRCh38:1:39084062:39487177:1 gene:ENSG00000127603 transcript:ENST00000567887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLEPAGLKTLRLVSMPSWCHTNNEEQAEEDDDDVPREKGRMRFHRLQNVQIALDFLKQ
RQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVT
AGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAERLGVT
RLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISATEVDSRWQEYQSRVDSLIP
WIKQHTILMSDKTFPQNPVELKALYNQYIHFKETEILAKEREKGRIEELYKLLEVWIEFG
RIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLELLLQIANKIQNGALNCEEKLT
LAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQVDLQILRDENYYQLEELAFR
VMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTTTHLKAEPLTKATHSSSTSWFRKP
MTRAELVAISSSEDEGNLRFVYELLSWVEEMQMKLERAEWGNDLPSVELQLETQQHIHTS
VEELGSSVKEARLYEGKMSQNFHTSYAETLGKLETQYCKLKETSSFRMRHLQSLHKFVSR
ATAELIWLNEKEEEELAYDWSDNNSNISAKRNYFSELTMELEEKQDVFRSLQDTAELLSL
ENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYFQFFSDARELESFLRNLQDS
IKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRSPDHVLK
NTISVKAVCDYRQIEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPPPNKD
AIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLDLVQTWNLEKLRSSAPGECHQ
IMKNLQAHYEDFLQDSRDSVLFSVADRLRLEEEVEACKARFQHLMKSMENEDKEETVAKM
YISELKNIRLRLEEYEQRVVKRIQSLASSRTDRDAWQDNALRIAEQEHTQEDLQQLRSDL
DAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLSTVYLNKLKTVDVIVRSIQD
AELLVKGYEIKLSQEEVVLADLSALEAHWSTLRHWLSDVKDKNSVFSVLDEEIAKAKVVA
EQMSRLTPERNLDLERYQEKGSQLQERWHRVIAQLEIRQSELESIQEVLGDYRACHGTLI
KWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTALFAEIERNQTKLDQCQKFSQQYSTIVK
DYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLRTRYTALVTLTTQHVKYISD
ALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQGKATSSETKESTDIEKAILEQQ
VLSEELTTKKEQVSEAIKTSQIFLAKHGHKLSEKEKKQISEQLNALNKAYHDLCDGSANQ
LQQLQSQLAHQTEQKECRAVAGVIDLGTVEIFPIFKAMQKGLLDQDTGLVLLESQVIMSG
LIAPETGENLSLEEGIARNLINPQMYQQLRELQDALALISRLTESRGPLSVVEAIEKRII
SETVGLKILEAHLATGGFSLSPSENCINLEEAFHQGLISAWLHSVLESYLRTSKNLIDPN
TAEKIGLLDLMQRCIVHQESGFKLLPVKQLAGGMVSLKSGRKVSIFRAVQEGLIDRQVTV
RLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMACAILIRQLQTGGIIDTVTGQRLT
IDEAVSNDLVAAKIALVILESLWSFMGLLWPESGEILPITDALEQGIVSTELAHKILSNR
QHIKALFLPATTEILSWKKAIESGILDRDLANNLKSICIPDVMPHMQLADSAEQNINPGA
AVLPCSKSHPKATASQSENLLFQLMTHSYINVQNGQRLLLLDKELMETLTSRDEYQTSPP
KVVEIGHQRQKTPEGLQESANVKISGTFSSGWTVRLPEFQFSSQNKEYPDREDCTTEKGK
KTTVETEDSSVENPEQDLFVEQKERNPNIDALKVINKVKLEVQRQLIGTQREDQTAVSVR
ENASRGHLLTIPPAEAEGVPLVVDKDVFSVETPKKEHQPLRNTSFTCQNEQAHTLETEYI
HDETGGSHIKPQSKKLQVQVKKTLGIKLELKSETDGNVHPLDKKEMLKKTFLAKDDHKES
QEAQNIAGGSMMMSEKTDEEDSGREIFLSCSHPLELLEEATLNVLSAQLLDGGIFHEQTG
QKLLLNEAISRGIVPSHTAVKLMEKLNMFQGFFDSQTCESLTTEEVINEGLMDEKLLHNV
LMADKAISGVLDPRTQTLCSVKDAVTVGLLDKETATRILERQVVTGGIIDLKRGKKVSVT
LASTLGLVDVADQPELINLEKASKGRDAEKTVRERLISLQMETTGLIDPDSKAPLTVVQS
IDRGLLEREEAVRLLTKQVVDGGIIHHISGMRLSVDNAFRHGLIGEDLAEKLKRVENLNI
HQIFNPETKENISLPKAIKLDLITSDLKREIQEVQAFTGNFVDLISGQRLTLAEAKKEGL
LTNEAVLSPGMMHGIVDPENCRIVPYSELVKKCKIDIESGQRYLEVIPFSDIKDGVSDKV
LTLSQAIQLGKVDFASTLKVLEAQANTGGIIDTATGKRLTLASALEEKLVDENMVRIIAS
HQVLNGGIVDIFSDQRVTLVEAIEKRLISPELANMIQIDSSEFSDHRAQIEKQEGIEVCA
LQNEFLGKDMLIACNQTAEMSCNKVEESERLFQVENQSAQEKVKVRVSDGEQAKKSREIS
LKEFGCKDQRKPRMSSDAKEFISIINPHNLKGKSLGQVSLTHPYSECDFKLKEVARNNMG
NDTNEEQEKAVTKIEIISHMKQSTSCLDSEEIRENQGEVILEVQETYCETSGKLPSEQVL
QQPMNARVKSKREKREVIVEESIRTCKPAFLSEEKLYQETAIRDEHDSHIKSQPREMTSS
EKGKEADTEMGFSITFKIEESSSQVVPQGISVKHLDALTLFSSKQANEGKVNNLSLCLTL
KPEENLSREIACGAQSEPFPCMTPRPEGLHYQESDGKAQVTGPSQISKTDKSFQGTTRQE
TNYQDSWVTSKTKETKHQISSSNECKEKSYQEVSFDPARGLKLEEITVSRPDSKEVRYLE
FSDRKDLHHQGSKSDDKLCGTLKSEIATQELTGEKFLEMANPNVAGLEAGSIEDIVTQRG
SRVLGSFLPEKLFKGVSQKENTGQQNAIISPTVLETSEEKTVSLTVCSAVKTEKTPQEKL
RESPGSEQTPFMTAPEGKGNGGVNPEPFRATQNVFTRQLCLEHDEKLVSYLSLLRNIEMR
TKQIQPLELNLAELQDLLCQAKVLERELKDLTTLVSQELECVNQIIISQPQEVPAQLLKA
LEKDAKNLQKSLSSVSDTWNSRLLHFQNAVEIEKTKVLNQHTQLEGRLQDLRAWVGNKNL
ILNSKGSNSEIDVDSLNLCLQQYEDLKQPMAERKAQLDALAFDIQFFISEHAQDLSPQQN
RQMLRLLNELQRSFQDILEQTAAQVDALQGHLQQMEQEALVKTLQKQQNTCHQQLEDLCS
WVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDDIQNRATSFATVVKDIEGFMEENQ
TKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAVTSALQQETEKSKAAKELAEN
KKKIDALLDWVTSVGSSGGQLLTNLPGMEQLSGASLEKGALDTTDGYMGVNQAPEKLDKQ
CEMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLTPEEQQMLQQKLGELKEQYSTSLA
QSEAELKQVQTLQDELQKFLQDHKEFESWLERSEKELENMHKGGSSPETLPSLLKRQGSF
SEDVISHKGDLRFVTISGQKVLDMENSFKEGKEPSEIGNLVKDKLKDATERYTALHSKCT
RLGSHLNMLLGQYHQFQNSADSLQAWMQACEANVEKLLSDTVASDPGVLQEQLATTKQLQ
EELAEHQVPVEKLQKVARDIMEIEGEPAPDHRHVQETTDSILSHFQSLSYSLAERSSLLQ
KAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSSGVIQEALATNMKLKQDIARQKSS
LEATREMVTRFMETADSTTAAVLQGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFEH
LSGKLQQFMENKSRMLASGNQPDQDITHFFQQIQELNLEMEDQQENLDTLEHLVTELSSC
GFALDLCQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETEG
SIPPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQGK
TGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHERQESLQAILNRME
EVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQKVK
EALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVTVARQRQLEESASHLACFQAAESQ
LRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTGP
GDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVRAVG
QRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEVKEAQTLCDELSVLIGEQYLKDEL
KKRLETVALPLQGLEDLAADRINRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPIS
AKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKNH
WEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSELRVTLDPVQLESSLL
RSKAMLNEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAVTEELQAKTG
SLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQALE
PQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEGIGQ
FHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIHVLKLDIEASEAEC
RHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEDFYRKLKGLNDA
TTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKD
CDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIA
NQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLE
SLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAK
IQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSPAEQGVLSEKIDSLQARYSEIQD
RCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHRQHADHLAL
NEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQ
ARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGEQIPQFQQRQKELKKEVMEHRLVL
DTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQA
ADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEIF
GTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEET
RALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMVE
EKYQKAENMYAQIKEEVRQRALALDEAVSQSTQFHDKIEPMLETLENLSSRLRMPPLIPA
EVDKIRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMV
FFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQ
QVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNKTWK
ERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVE
VYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGAL
LALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVET
VNKAGNELLESSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIE
DFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLS
RDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLTLAE
QSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIK
NLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISN
DPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEVRDKW
DTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMD
AHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQS
RLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKKVEEK
RVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVA
NAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTK
TYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLL
ALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKIT
RQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKI
EDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWM
ALDEFLVKNDPCRVHHPGSKIKRSDSSSSISSQSPIARGRTNIELREKFILPEGASQGMT
PFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKTSLQFSRCYDKPW
LVNSKAGTPIRDSHSPDLQLPTPEVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPAST
GAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQ
GNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences H3BQK9
ENSP00000444364 ENSP00000455823 ENSP00000455823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]