SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455949 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455949
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.44e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000148
Further Details:      
 
Domain Number 2 Region: 133-185
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.9e-16
Family Middle domain of MutM-like DNA repair proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455949   Gene: ENSG00000140398   Transcript: ENST00000567657
Sequence length 185
Comment pep:known chromosome:GRCh38:15:75347435:75352230:1 gene:ENSG00000140398 transcript:ENST00000567657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYR
Download sequence
Identical sequences ENSP00000455949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]