SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456015 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456015
Domain Number 1 Region: 141-203
Classification Level Classification E-value
Superfamily BPTI-like 4.54e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 
Domain Number 2 Region: 58-121
Classification Level Classification E-value
Superfamily BPTI-like 6.53e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSP00000456015
Domain Number - Region: 31-60
Classification Level Classification E-value
Superfamily PKD domain 0.00388
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456015   Gene: ENSG00000166145   Transcript: ENST00000566928
Sequence length 240
Comment pep:novel chromosome:GRCh38:15:40853196:40856826:1 gene:ENSG00000166145 transcript:ENST00000566928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTVLS
TKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRG
VQGPSMERRHPDTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVV
Download sequence
Identical sequences H3BR01
ENSP00000456015 ENSP00000456015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]