SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456096 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456096
Domain Number 1 Region: 35-142
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.34e-34
Family Matrix metalloproteases, catalytic domain 0.000000968
Further Details:      
 
Domain Number 2 Region: 145-200
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-21
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000726
Family MMP N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456096   Gene: ENSG00000087245   Transcript: ENST00000564864
Sequence length 201
Comment pep:putative chromosome:GRCh38:16:55479998:55485776:1 gene:ENSG00000087245 transcript:ENST00000564864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLD
PETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFA
PGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGF
LWCSTTYNFEKDGKYGFCPHE
Download sequence
Identical sequences A0A2J8MWR1 H3BR66
ENSP00000456096 ENSP00000456096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]