SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456260 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456260
Domain Number 1 Region: 91-209
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.00000000000000194
Family ATP-dependent DNA ligase catalytic domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456260   Gene: ENSG00000169371   Transcript: ENST00000569817
Sequence length 210
Comment pep:known chromosome:GRCh38:15:75605199:75626159:-1 gene:ENSG00000169371 transcript:ENST00000569817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWI
VVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN
QTYYVLDVMCWRGHPFYDCQTDFRFYWMHS
Download sequence
Identical sequences ENSP00000456260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]