SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456518 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456518
Domain Number 1 Region: 88-249
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.63e-60
Family Hemopexin-like domain 0.0000000172
Further Details:      
 
Domain Number 2 Region: 5-72
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.05e-21
Family Matrix metalloproteases, catalytic domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456518   Gene: ENSG00000087245   Transcript: ENST00000570283
Sequence length 252
Comment pep:novel chromosome:GRCh38:16:55488662:55502889:1 gene:ENSG00000087245 transcript:ENST00000570283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTTEDYDRDKKYGFCPETGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQ
DDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWR
TVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKP
LTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPD
NLDAVVDLQGGG
Download sequence
Identical sequences ENSP00000456518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]