SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456625 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456625
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000394
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456625   Gene: ENSG00000050820   Transcript: ENST00000568864
Sequence length 135
Comment pep:putative chromosome:GRCh38:16:75242611:75264416:-1 gene:ENSG00000050820 transcript:ENST00000568864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGL
HAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFS
KQTPHHPFPSPATDL
Download sequence
Identical sequences A0A2J8Q6B5 H3BSB2
ENSP00000456625 ENSP00000456625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]