SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456709 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456709
Domain Number 1 Region: 32-325
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.33e-44
Family WD40-repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 182-305,403-582
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.05e-32
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456709   Gene: ENSG00000141076   Transcript: ENST00000562237
Sequence length 700
Comment pep:putative chromosome:GRCh38:16:69132596:69169020:1 gene:ENSG00000141076 transcript:ENST00000562237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSTSGAEPESARARGAGAERGEHREGERGAAGIRCVAYNNQSNRLAVSRTDGTVEIYNLS
ANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQALNIKYAMDAFGGPIWS
MAASPSGSQLLVGCEDGSVKLFQITPDKIQFERNFDRQKSRILSLSWHPSGTHIAAGSID
YISVFDVKSGSAVHKMIVDRQYMGVSKRKCIVWGVAFLSDGTIISVDSAGKVQFWDSATG
TLVKSHLIANADVQSIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHH
THDVRTVAHSPTALISGGTDTHLVFRPLMEKVEVKNYDAALRKITFPHRCLISCSKKRQL
LLFQFAHHLELWRLGSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISPCGSWIA
YSTVSRFFLYRLNYEHDNISLKRVSKMPAFLRSALQILFSEDSTKLFVASNQGALHIVQL
SGGSFKHLHAFQPQSGTVEAMCLLAVSPDGNWLAASGTSAGVHVYNVKQLKLHCTVPAYN
FPVTAMAIAPNTNNLVIAHSDQQVFEYSIPDKQYTDWSRTVQKQGFHHLWLQRDTPITHI
SFHPKRPMHILLHDAYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKI
YKPLLFMDLLDERTLVAVERPLDDIIAQLPPPIKKKKFGT
Download sequence
Identical sequences H3BSH7
ENSP00000456709 ENSP00000456317 ENSP00000456709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]