SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457056 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457056
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.83e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000148
Further Details:      
 
Weak hits

Sequence:  ENSP00000457056
Domain Number - Region: 144-198
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00165
Family Middle domain of MutM-like DNA repair proteins 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457056   Gene: ENSG00000140398   Transcript: ENST00000565051
Sequence length 199
Comment pep:known chromosome:GRCh38:15:75347727:75352701:1 gene:ENSG00000140398 transcript:ENST00000565051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKL
QNPDLLELCHSVPKEVVQL
Download sequence
Identical sequences H3BT75
ENSP00000457056 ENSP00000457056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]