SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457081 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000457081
Domain Number - Region: 2-49
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00022
Family N-terminal domain of MutM-like DNA repair proteins 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457081   Gene: ENSG00000140398   Transcript: ENST00000566313
Sequence length 51
Comment pep:known chromosome:GRCh38:15:75347038:75349057:1 gene:ENSG00000140398 transcript:ENST00000566313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASA
Download sequence
Identical sequences A0A2J8KS72 A0A2J8UDP9
ENSP00000457081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]