SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457279 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457279
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-36
Family Eukaryotic proteases 0.00000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457279   Gene: ENSG00000168928   Transcript: ENST00000567767
Sequence length 114
Comment pep:putative chromosome:GRCh38:16:75204103:75205992:-1 gene:ENSG00000168928 transcript:ENST00000567767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKF
SILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNG
Download sequence
Identical sequences H3BTQ4
ENSP00000457279 ENSP00000457279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]