SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457541 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457541
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00000000151
Family N-terminal domain of MutM-like DNA repair proteins 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457541   Gene: ENSG00000140398   Transcript: ENST00000566752
Sequence length 64
Comment pep:known chromosome:GRCh38:15:75347013:75349098:1 gene:ENSG00000140398 transcript:ENST00000566752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLP
Download sequence
Identical sequences A0A2J8KS59 A0A2J8UDQ6 H3BU98
ENSP00000457541 ENSP00000457541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]