SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458145 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458145
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.0000000000981
Family Carbonic anhydrase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458145   Gene: ENSG00000154975   Transcript: ENST00000575097
Sequence length 56
Comment pep:putative chromosome:GRCh38:17:51661593:51747788:-1 gene:ENSG00000154975 transcript:ENST00000575097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEEKVC
Download sequence
Identical sequences A0A1D5QWG0 I3L0J7
ENSP00000458145 ENSP00000458145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]