SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458456 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458456
Domain Number 1 Region: 160-308
Classification Level Classification E-value
Superfamily TPR-like 2.09e-22
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 2 Region: 7-81,119-144
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000000417
Family FKBP immunophilin/proline isomerase 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458456   Gene: ENSG00000129221   Transcript: ENST00000574506
Sequence length 372
Comment pep:novel chromosome:GRCh38:17:6424534:6435133:-1 gene:ENSG00000129221 transcript:ENST00000574506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAALLLNVEGVKKTILHGGTGELPNFITGSRERTVIDDSRQVGQPMHIIIGNMFKLEVW
EILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTL
GYEDLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEGNRLFKLG
RYEEASSKYQEAIICLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEH
TSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRM
AEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPAT
EPPPSPGHSLQH
Download sequence
Identical sequences Q7Z3H1
ENSP00000458456 NP_001272328.1.87134 NP_001272328.1.92137 ENSP00000458456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]