SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458585 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458585
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.31e-67
Family Hemopexin-like domain 0.00000124
Further Details:      
 
Domain Number 2 Region: 102-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-57
Family Matrix metalloproteases, catalytic domain 0.0000000649
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 4.87e-20
Family MMP N-terminal domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458585   Gene: ENSG00000262406   Transcript: ENST00000571244
Sequence length 470
Comment pep:known chromosome:GRCh38:11:102862736:102875034:-1 gene:ENSG00000262406 transcript:ENST00000571244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTY
KYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF
FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRP
EPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITK
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC
Download sequence
Identical sequences P39900
ENSP00000458585 NP_002417.2.87134 NP_002417.2.92137 gi|73858572|ref|NP_002417.2| ENSP00000458585 ENSP00000458585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]