SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458824 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458824
Domain Number 1 Region: 32-130
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.22e-29
Family Eukaryotic type heme oxygenase 0.000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458824   Gene: ENSG00000103415   Transcript: ENST00000576827
Sequence length 131
Comment pep:known chromosome:GRCh38:16:4476439:4507902:1 gene:ENSG00000103415 transcript:ENST00000576827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAA
Download sequence
Identical sequences A0A1B0GXH0 A0A2J8LAP6
ENSP00000458824 ENSP00000461428 ENSP00000458824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]