SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458841 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458841
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-27
Family ALDH-like 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458841   Gene: ENSG00000108602   Transcript: ENST00000574162
Sequence length 131
Comment pep:known chromosome:GRCh38:17:19743232:19748943:-1 gene:ENSG00000108602 transcript:ENST00000574162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAA
Download sequence
Identical sequences I3L1H6
ENSP00000458841 ENSP00000458841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]