SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458942 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458942
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily ALDH-like 8.77e-44
Family ALDH-like 0.000000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458942   Gene: ENSG00000072210   Transcript: ENST00000571537
Sequence length 162
Comment pep:putative chromosome:GRCh38:17:19656402:19661442:1 gene:ENSG00000072210 transcript:ENST00000571537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRI
TWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFK
RILSLLEGQKIAFGGETDEATRYIGNGNSPFPMGRWQFGSFC
Download sequence
Identical sequences I3L1M4
ENSP00000458942 ENSP00000458942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]