SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459101 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459101
Domain Number 1 Region: 97-160
Classification Level Classification E-value
Superfamily RILP dimerisation region 7.45e-18
Family RILP dimerisation region 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459101   Gene: ENSG00000167705   Transcript: ENST00000574810
Sequence length 226
Comment pep:novel chromosome:GRCh38:17:1646145:1649032:-1 gene:ENSG00000167705 transcript:ENST00000574810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQ
EPEWATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKE
ELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSFGLWYRGKAESS
EDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA
Download sequence
Identical sequences A0A0J9YWQ1 I3L1U0
ENSP00000459101 ENSP00000459101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]