SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459557 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459557
Domain Number 1 Region: 1-32
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000592
Family Glyoxalase I (lactoylglutathione lyase) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459557   Gene: ENSG00000167699   Transcript: ENST00000574581
Sequence length 52
Comment pep:known chromosome:GRCh38:17:770429:782255:-1 gene:ENSG00000167699 transcript:ENST00000574581 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAARRALHFVFKVGNRFQTARFYRDVLGMKVESCSVARLECSGAISAHCSAA
Download sequence
Identical sequences I3L2C2
ENSP00000459557 ENSP00000459557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]